Yahoo Web Search

Search results

1. Dictionary

   For·ward

   /ˈfôrwərd/

   

   adverb

   • 1. in the direction that one is facing or traveling; toward the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or toward the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backward as forward"
   • 2. onward so as to make progress; toward a successful conclusion: "there's no way forward for the relationship" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar toward the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. toward the future; ahead in time: "from that day forward, the assembly was at odds with us" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to winter"

   adjective

   • 1. directed or facing toward the front or the direction that one is facing or traveling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or toward the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to or concerned with the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. moving or tending onward to a successful conclusion: "the decision is a forward step"
   • ▪ developing or acting earlier than expected or required; advanced or precocious: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or familiar in manner, especially in a presumptuous way: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in basketball, hockey, or other sports.
   • ▪ an offensive or defensive lineman.
   • 2. short for forward contract

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ hand over or send (an official document): "their final report was forwarded to the Commanding Officer"
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavorsupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. www.dictionary.com › browse › forwardFORWARD Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

3. dictionary.cambridge.org › learner-english › forwardFORWARD | meaning - Cambridge Learner's Dictionary

   dictionary.cambridge.org › learner-english › forward

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the future: 3. used to say that…. Learn more.

4. www.ldoceonline.com › dictionary › forwardforward | meaning of forward in Longman Dictionary of ...

   www.ldoceonline.com › dictionary › forward

   • Cached

   forward meaning, definition, what is forward: towards a place or position that is in f...: Learn more.

5. www.oxfordlearnersdictionaries.com › forward_3forward verb - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › forward_3

   • Cached

   forward something (formal) to help to improve or develop something synonym further. He saw the assignment as a way to forward his career. She uses various devices to forward the plot. They have done a great deal to forward the cause of world peace. see also fast-forward

6. www.collinsdictionary.com › english › forwardFORWARD definition in American English | Collins English ...

   www.collinsdictionary.com › english › forward

   • Cached

   directed or moving ahead. 2. lying or situated in or near the front part of something. 3. presumptuous, pert, or impudent. a forward remark. 4. well developed or advanced, esp in physical, material, or intellectual growth or development. forward ideas.

7. en.wiktionary.org › wiki › forwardforward - Wiktionary, the free dictionary

   en.wiktionary.org › wiki › forward

   • Cached

   Jun 14, 2024 · the forward gun in a ship, the forward ship in a fleet (of troops, guns etc.) Situated toward or near the enemy lines.The forward battalion took a hammering.; Acting in or pertaining to the direction in which someone or something is facing.

8. www.oxfordlearnersdictionaries.com › us › definitionforward adverb - Definition, pictures, pronunciation and ...

   www.oxfordlearnersdictionaries.com › us › definition

   • Cached

   forward of something The main cabin is situated forward of (= in front of) the mast. Topics Transport by water c1 Word Origin Old English forweard (in the sense ‘towards the future’, as in from this day forward ), variant of forthweard (see forth , -ward ).