Yahoo Web Search

Search results

1. Dictionary

   For·ward

   /ˈfôrwərd/

   

   adverb

   • 1. in the direction that one is facing or traveling; toward the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or toward the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backward as forward"
   • 2. onward so as to make progress; toward a successful conclusion: "there's no way forward for the relationship" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar toward the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. toward the future; ahead in time: "from that day forward, the assembly was at odds with us" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to winter"

   adjective

   • 1. directed or facing toward the front or the direction that one is facing or traveling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or toward the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to or concerned with the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. moving or tending onward to a successful conclusion: "the decision is a forward step"
   • ▪ developing or acting earlier than expected or required; advanced or precocious: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or familiar in manner, especially in a presumptuous way: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in basketball, hockey, or other sports.
   • ▪ an offensive or defensive lineman.
   • 2. short for forward contract

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ hand over or send (an official document): "their final report was forwarded to the Commanding Officer"
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavorsupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. www.dictionary.com › browse › forwardFORWARD Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

3. dictionary.cambridge.org › learner-english › forwardFORWARD | meaning - Cambridge Learner's Dictionary

   dictionary.cambridge.org › learner-english › forward

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the future: 3. used to say that…. Learn more.

4. www.oxfordlearnersdictionaries.com › forward_3forward verb - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › forward_3

   • Cached

   Definition of forward verb in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

5. www.ldoceonline.com › dictionary › forwardforward | meaning of forward in Longman Dictionary of ...

   www.ldoceonline.com › dictionary › forward

   • Cached

   forward meaning, definition, what is forward: towards a place or position that is in f...: Learn more.

6. www.collinsdictionary.com › english › forwardFORWARD definition in American English | Collins English ...

   www.collinsdictionary.com › english › forward

   • Cached

   forward applies to any movement toward what is or is conceived to be the front or a goal: to face forward; to move forward in the aisles. onward applies to any movement in continuance of a course: to march onward toward a goal.

7. dictionary.cambridge.org › us › dictionaryFORWARD | definition in the Cambridge English Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   Jun 10, 2024 · FORWARD meaning: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

8. www.oxfordlearnersdictionaries.com › us › definitionforward adverb - Definition, pictures, pronunciation and ...

   www.oxfordlearnersdictionaries.com › us › definition

   • Cached

   to change the time shown by clocks, usually by one hour, when the time changes officially, for example at the beginning and end of summer. Remember to put your clocks back tonight. Definition of forward adverb in Oxford Advanced Learner's Dictionary.