Yahoo Web Search

Search results

1. Dictionary

   Am·pli·fy

   /ˈampləˌfī/

   

   verb

   • 1. increase the volume of (sound), especially using an amplifier: "the accompanying chords have been amplified in our arrangement" Similar loudenmake louderturn upincreasebooststep upraisemagnifyintensifyescalateswellheightenadd toaugmentsupplementOpposite reducequiet
   • ▪ increase the amplitude of (an electrical signal or other oscillation).
   • ▪ cause to become more marked or intense: "urban policy initiatives amplified social polarization"
   • ▪ make multiple copies of (a gene or DNA sequence).
   • ▪ enlarge upon or add detail to (a story or statement): "the notes amplify information contained in the statement" Similar expandenlarge onelaborate onadd todevelopflesh outadd flesh toadd detail togo into detail aboutembroidersupplementaugmentreinforceOpposite condense

   Word Origin late Middle English (in the general sense ‘increase, augment’): from Old French amplifier, from Latin amplificare, from amplus ‘large, abundant’.

   Scrabble Points: 17

   • A

     1

   • M

     3

   • P

     3

   • L

     1

   • I

     1

   • F

     4

   • Y

     4

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. www.oxfordlearnersdictionaries.com › us › definitionamplify verb - Definition, pictures, pronunciation and usage...

   www.oxfordlearnersdictionaries.com › us › definition

   • Cached

   Definition of amplify verb in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

3. www.vocabulary.com › dictionary › amplifyAmplify - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › amplify

   The verb amplify means to crank up the volume. Speakers amplify, or raise, the volume of the noise coming through a microphone so that everyone at the rock show can hear. Amplify comes from the Old French word amplifier meaning "to enlarge or expand."

4. www.thefreedictionary.com › amplifyAmplify - definition of amplify by The Free Dictionary

   www.thefreedictionary.com › amplify

   • Cached

   1. To make larger or more powerful; increase. 2. To add to, as by illustrations; make complete. 3. To exaggerate. 4. To produce amplification of: amplify an electrical signal. v.intr. To write or discourse at length; expatiate: Let me amplify so that you will understand the overall problem.

5. www.collinsdictionary.com › dictionary › englishAMPLIFY definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   2 days ago · To amplify something means to increase its strength or intensity . The mist had been replaced by a kind of haze that seemed to amplify the heat. [VERB noun] Her anxiety about the world was amplifying her personal fears about her future. [VERB noun] amplification uncountable noun.

6. dictionary.cambridge.org › us › dictionaryAMPLIFY | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   Definition of amplify – Learner’s Dictionary. amplify. verb [ T ] uk / ˈæmplɪfaɪ / us. amplify verb [T] (SOUND) Add to word list. to make a sound louder using electronic equipment. amplify verb [T] (OPINION) to make a feeling or opinion stronger or clearer. amplification. noun [ U ] uk / ˌæmplɪfɪˈkeɪʃ ə n / us.

7. www.yourdictionary.com › amplifyAmplify Definition & Meaning | YourDictionary

   www.yourdictionary.com › amplify

   • Cached

   Amplify Definition. ămplə-fī. amplified, amplifies, amplifying. Meanings. Synonyms. Sentences. Definition Source. Origin. Verb. Filter. verb. amplified, amplifies, amplifying. To make larger or more powerful; increase. American Heritage. To make larger or stronger; increase or extend (power, authority, etc.) Webster's New World.

8. www.ldoceonline.com › dictionary › amplifyamplify | meaning of amplify in Longman Dictionary of...

   www.ldoceonline.com › dictionary › amplify

   • Cached

   amplify meaning, definition, what is amplify: to make sound louder, especially musical...: Learn more.