Yahoo Web Search

Search results

1. Dictionary

   For·ward

   /ˈfôrwərd/

   

   adverb

   • 1. in the direction that one is facing or traveling; toward the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or toward the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backward as forward"
   • 2. onward so as to make progress; toward a successful conclusion: "there's no way forward for the relationship" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar toward the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. toward the future; ahead in time: "from that day forward, the assembly was at odds with us" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to winter"

   adjective

   • 1. directed or facing toward the front or the direction that one is facing or traveling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or toward the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to or concerned with the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. moving or tending onward to a successful conclusion: "the decision is a forward step"
   • ▪ developing or acting earlier than expected or required; advanced or precocious: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or familiar in manner, especially in a presumptuous way: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in basketball, hockey, or other sports.
   • ▪ an offensive or defensive lineman.
   • 2. short for forward contract

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ hand over or send (an official document): "their final report was forwarded to the Commanding Officer"
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavorsupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. dictionary.cambridge.org › us › dictionaryFORWARD | definition in the Cambridge English Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   verb [ T ] us / ˈfɔːr.wɚd / uk / ˈfɔː.wəd /. to send a letter, etc., especially from someone's old address to their new address, or to send a letter, email, etc. that you have received to someone else: forward something to someone/something I'll forward any mail to your new address.

3. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   6 days ago · If something or someone is put forward, or comes forward, they are suggested or offered as suitable for a particular purpose. Over the years several similar theories have been put forward. Next month the Commission is to bring forward its first proposals for action. He was putting himself forward as a Democrat.

4. www.vocabulary.com › dictionary › forwardForward - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › forward

   Forward is the direction ahead of you, or toward the front of something. It can also be a position on a basketball, soccer, or hockey team. Forward can be a direction of either space or time, and also implies progress. A forward-thinking person thinks about what will happen in the future.

5. dictionary.cambridge.org › us › dictionaryFORWARD | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   B1. towards the direction that is in front of you: She leaned forward to make sure I could hear her. Fewer examples. She leaned forward and whispered in my ear. The bus stopped suddenly and the passengers were thrown forward. The car lurched forward before hitting the tree. She took a few steps forward and then started to speak.

6. www.thefreedictionary.com › forwardForward - definition of forward by The Free Dictionary

   www.thefreedictionary.com › forward

   • Cached

   1. a. At, near, or belonging to the front or forepart; fore: the forward section of the aircraft. b. Located ahead or in advance: kept her eye on the forward horizon. 2. a. Going, tending, or moving toward a position in front: a forward plunge down a flight of stairs. b. Sports Advancing toward an opponent's goal.

7. www.dictionary.com › browse › forwardFORWARD Definition & Usage Examples | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   adjective. directed toward a point in advance; moving ahead; onward: The chest-high snow made forward motion almost impossible. being in a condition of advancement; well-advanced: It was quite forward in the season when we finished our planting. presumptuous, impertinent, or bold: That girl is a rude, forward child.

8. www.oxfordlearnersdictionaries.com › definition › americanforward verb - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › definition › american

   • Cached

   forward. verb. /ˈfɔrwərd/ Verb Forms. to send or pass goods or information to someone forward something to somebody We will be forwarding our new catalog to you next week. forward somebody something We will be forwarding you our new catalog next week. forward something to forward a request/complaint/proposal. Take your English to the next level.