Yahoo Web Search

Search results

1. Dictionary

   Coat

   /kōt/

   

   noun

   • 1. an outer garment worn outdoors, having sleeves and typically extending below the hips: "a winter coat" Similar overcoattunic
   • ▪ an outer garment having sleeves and extending below the hips worn indoors as a protective garment: "a laboratory coat"
   • ▪ a man's jacket or tunic, especially as worn when hunting or by soldiers.
   • ▪ a man's or woman's tailored jacket: "she wore a pale linen coat and skirt"
   • 2. an animal's covering of fur or hair: "a dog's coat may become tangled and matted" Similar furhairwoolfleecehidepeltskinarchaic:fell
   • 3. an outer layer or covering of a specified kind: "the protein coat of the virus" Similar layercoveringoverlaycoatingskinskimplatingfilmwashglazevarnishveneerlaminationsheetfinishdustingblanketmantledaubsmeartoppingcrustpatinalusterdepositscalefacingcladding
   • ▪ a covering of paint or similar material laid on a surface at one time: "a protective coat of varnish"
   • ▪ a structure, especially a membrane, enclosing or lining an organ.
   • ▪ a skin, rind, or husk.
   • ▪ a layer of a plant bulb.

   verb

   • 1. provide with a layer or covering of something; apply a coat to: "coat each part with a thin oil"
   • ▪ (of a substance) form a covering to: "a film of dust coated the floor"

   Word Origin Middle English: from Old French cote, of unknown ultimate origin.

   Derivatives

   • 1. coated adjective

   Scrabble Points: 6

   • C

     3

   • O

     1

   • A

     1

   • T

     1

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. People also ask

   What is coat noun?

   • Definition of coat noun from the Oxford Advanced American Dictionary a piece of outdoor clothing that is worn over other clothes to keep warm or dry. Coats have sleeves and may be long or short a fur/leather coat a long winter coat to put on/take off your coat see duffel coat, housecoat, overcoat, petticoat, raincoat, trench coat

   coat noun - Definition, pictures, pronunciation and usage notes

   www.oxfordlearnersdictionaries.com/definition/american_english/coat_1

   See all results for this question

   What is the difference between a coat and an animal's coat?

   • A coat is a piece of clothing with long sleeves which you wear over your other clothes when you go outside. He turned off the television, put on his coat and walked out. An animal's coat is the fur or hair on its body. Vitamin B6 is great for improving the condition of dogs' and horses' coats.

   COAT definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/coat

   See all results for this question

   What is a coat of paint?

   • paint A coat of paint or varnish is a thin layer of it on a surface. The front door needs a new coat of paint. If you coat something with a substance or in a substance, you cover it with a thin layer of the substance. Coat the fish with seasoned flour.

   COAT definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/coat

   See all results for this question

   What is a hypernym for a coat?

   • Hypernyms ("coat" is a kind of...): outer garment; overgarment (a garment worn over other garments) coattail (the loose back flap of a coat that hangs below the waist) sack coat (man's hiplength coat with a straight back; the jacket of a suit) newmarket (a long close-fitting coat worn for riding in the 19th century)

   What does coat mean? definition, meaning and audio

   www.audioenglish.org/dictionary/coat.htm

   See all results for this question

3. www.wordsmyth.netcoat | Dictionaries and vocabulary tools for English language ...

   www.wordsmyth.net

   • Cached

   definition 1: an outer article of clothing with long sleeves, usu. worn for added warmth. He put on his wool coat over his suit. similar words: jacket, mackinaw, mackintosh, overcoat, parka, raincoat, slicker, topcoat, windbreaker, wrap. definition 2: the jacket of a suit.

4. www.oxfordlearnersdictionaries.com › us › definitioncoat noun - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › us › definition

   • Cached

   Definition of coat noun in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

5. www.oxfordlearnersdictionaries.com › coat_2coat verb - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › coat_2

   • Cached

   coat something (with/in something) to cover something with a layer of a substance. The cookies were thickly coated with chocolate. A film of dust coated the table. The mask was coated in gold leaf.

6. www.oxfordlearnersdictionaries.com › coat_1coat noun - Definition, pictures, pronunciation and usage ...

   www.oxfordlearnersdictionaries.com › coat_1

   • Cached

   noun. /koʊt/. a piece of outdoor clothing that is worn over other clothes to keep warm or dry. Coats have sleeves and may be long or short a fur/leather coat a long winter coat to put on/take off your coat see duffel coat, housecoat, overcoat, petticoat, raincoat, trench coat. Definitions on the go.

7. www.oed.com › dictionary › coat_ncoat, n. meanings, etymology and more - Oxford English Dictionary

   www.oed.com › dictionary › coat_n

   • Cached

   There are 17 meanings listed in OED's entry for the noun coat, three of which are labelled obsolete. See ‘Meaning & use’ for definitions, usage, and quotation evidence.

8. dictionary.cambridge.org › learner-english › coatCOAT | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › learner-english › coat

   • Cached

   COAT meaning: 1. a piece of clothing with sleeves that you wear over your other clothes, especially when you go…. Learn more.

9. www.collinsdictionary.com › dictionary › englishCOAT definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   A coat is a piece of clothing with long sleeves which you wear over your other clothes when you go outside.