Yahoo Web Search

Search results

1. Dictionary

   For·ward

   /ˈfôrwərd/

   

   adverb

   • 1. in the direction that one is facing or traveling; toward the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or toward the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backward as forward"
   • 2. onward so as to make progress; toward a successful conclusion: "there's no way forward for the relationship" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar toward the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. toward the future; ahead in time: "from that day forward, the assembly was at odds with us" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to winter"

   adjective

   • 1. directed or facing toward the front or the direction that one is facing or traveling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or toward the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to or concerned with the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. moving or tending onward to a successful conclusion: "the decision is a forward step"
   • ▪ developing or acting earlier than expected or required; advanced or precocious: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or familiar in manner, especially in a presumptuous way: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in basketball, hockey, or other sports.
   • ▪ an offensive or defensive lineman.
   • 2. short for forward contract

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ hand over or send (an official document): "their final report was forwarded to the Commanding Officer"
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavorsupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. www.ldoceonline.com › dictionary › forwardforward | meaning of forward in Longman Dictionary of ...

   www.ldoceonline.com › dictionary › forward

   • Cached

   From Longman Dictionary of Contemporary English for‧ward1 /ˈfɔːwəd $ ˈfɔːrwərd/ S1 W1 (also forwards /-wədz $ -wərdz/) adverb 1 towards a place or position that is in front of you OPP backwards He leaned forward, his elbows resting on the table. The crowd surged forwards.

3. en.m.wiktionary.org › wiki › forwardforward - Wiktionary, the free dictionary

   en.m.wiktionary.org › wiki › forward

   • Cached

   Apr 9, 2024 · forward (not comparable) ( not comparable) Situated toward or at the front of something. The fire was confined to the forward portion of the store. the forward gun in a ship, the forward ship in a fleet. (of troops, guns etc.) Situated toward or near the enemy lines. The forward battalion took a hammering.

4. www.collinsdictionary.com › us › dictionaryFORWARD definition in American English | Collins English ...

   www.collinsdictionary.com › us › dictionary

   • Cached

   2 days ago · 1. adverb [ADV after v] If you move or look forward, you move or look in a direction that is in front of you. He came forward with his hand out. "Mr. and Mrs. Selby?" he said. She fell forward on to her face. 2. adverb. Forward means in a position near the front of something such as a building or a vehicle.

5. www.oxfordlearnersdictionaries.com › us › definitionforward adverb - Definition, pictures, pronunciation and ...

   www.oxfordlearnersdictionaries.com › us › definition

   • Cached

   Check pronunciation: forward. Definition of forward adverb in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

6. www.wordsmyth.netforward | Dictionaries and vocabulary tools for English ...

   www.wordsmyth.net

   • Cached

   adverb, adjective, noun, transitive verb. features: Word Combinations ( adjective, noun, verb) The meaning of forward. Definition of forward. English dictionary and integrated thesaurus for learners, writers, teachers, and students with advanced, intermediate, and beginner levels.

7. www.oed.com › dictionary › forward_adjforward, adj., n., & adv. meanings, etymology and more ...

   www.oed.com › dictionary › forward_adj

   • Cached

   What does the word forward mean? There are 47 meanings listed in OED's entry for the word forward, 17 of which are labelled obsolete. See ‘Meaning & use’ for definitions, usage, and quotation evidence. forward has developed meanings and uses in subjects including.

8. dictionary.cambridge.org › us › thesaurusFORWARD - 73 Synonyms and Antonyms - Cambridge English

   dictionary.cambridge.org › us › thesaurus

   • Cached

   adverb. These are words and phrases related to forward. Click on any word or phrase to go to its thesaurus page. Or, go to the definition of forward. The cars moved forward very slowly. Synonyms. ahead. onward. in advance. in front. toward the front. forth. frontward. before. toward the future. Antonyms. backward. to the rear.