Yahoo Web Search

Search results

1. Dictionary

   Coat

   /kōt/

   

   noun

   • 1. an outer garment worn outdoors, having sleeves and typically extending below the hips: "a winter coat" Similar overcoattunic
   • ▪ an outer garment having sleeves and extending below the hips worn indoors as a protective garment: "a laboratory coat"
   • ▪ a man's jacket or tunic, especially as worn when hunting or by soldiers.
   • ▪ a man's or woman's tailored jacket: "she wore a pale linen coat and skirt"
   • 2. an animal's covering of fur or hair: "a dog's coat may become tangled and matted" Similar furhairwoolfleecehidepeltskinarchaic:fell
   • 3. an outer layer or covering of a specified kind: "the protein coat of the virus" Similar layercoveringoverlaycoatingskinskimplatingfilmwashglazevarnishveneerlaminationsheetfinishdustingblanketmantledaubsmeartoppingcrustpatinalusterdepositscalefacingcladding
   • ▪ a covering of paint or similar material laid on a surface at one time: "a protective coat of varnish"
   • ▪ a structure, especially a membrane, enclosing or lining an organ.
   • ▪ a skin, rind, or husk.
   • ▪ a layer of a plant bulb.

   verb

   • 1. provide with a layer or covering of something; apply a coat to: "coat each part with a thin oil"
   • ▪ (of a substance) form a covering to: "a film of dust coated the floor"

   Word Origin Middle English: from Old French cote, of unknown ultimate origin.

   Derivatives

   • 1. coated adjective

   Scrabble Points: 6

   • C

     3

   • O

     1

   • A

     1

   • T

     1

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less