Yahoo Web Search

Search results

1. Dictionary

   Read·y

   /ˈredē/

   

   adjective

   • 1. in a suitable state for an activity, action, or situation; fully prepared: "are you ready, Carrie?" Similar preparedall setsetorganizedin a fit stateequippedprimedall systems goinformal:fitpsyched upgeared upup for ithot to trotOpposite unpreparedtaken by surprise
   • ▪ (of a thing) made suitable and available for immediate use: "dinner's ready!" Similar completedfinishedpreparedorganizeddonearrangedfixedin readinessripeinformal:done and dustedOpposite incompletein preparation
   • ▪ keen or quick to give: "I'm always ready with a wisecrack"
   • ▪ in need of or having a desire for: "I expect you're ready for a drink"
   • ▪ eager, inclined, or willing to do something: "she is ready to die for her political convictions" Similar willingpreparedpleasedinclinedagreeabledisposedpredisposedmindedof a mindin the moodaptpronegivenlikelyeagerkeenhappygladinformal:gameOpposite reluctantunwilling
   • ▪ in such a condition as to be likely to do something: "by the time he arrived he was ready to drop" Similar about toon the point ofon the verge ofon the brink ofclose toas if one is going toin danger ofliable tolikely to
   • 2. easily available or obtained; within reach: "there was a ready supply of drink"
   • ▪ immediate, quick, or prompt: "those who have ready access to the arts" Similar easily availableavailableaccessiblehandyclose at handat handto handon handnear at handconvenientwithin reachat the readynearat one's fingertipsat one's disposalon callinformal:on tappromptquickrapidswiftspeedyfastimmediateunhesitatingtimelycleversharpastuteshrewdkeenacuteperceptivediscerningresourcefulsmartbrightalertaptadroitdeftagileskillfularchaic:rathe

   noun

   • 1. available money; cash. informal British

   verb

   • 1. prepare (someone or something) for an activity or purpose: "the spare transformer was readied for shipment"

   Word Origin Middle English: from Old Englishrǣde (from a Germanic base meaning ‘arrange, prepare’; related to Dutch gereed) + -y1.

   Scrabble Points: 9

   • R

     1

   • E

     1

   • A

     1

   • D

     2

   • Y

     4

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. www.merriam-webster.com › dictionary › readyReady Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › ready

   • Cached

   Synonyms of ready. 1. a. : prepared mentally or physically for some experience or action. b. : prepared for immediate use. dinner is ready. 2. a. : willingly disposed : inclined. ready to agree to his proposal. b. : likely to do something indicated. a house that looks ready to collapse. 3. : displayed readily and spontaneously. a ready wit. 4.

3. www.synonyms.com › synonym › readyReady Synonyms & Antonyms | Synonyms.com

   www.synonyms.com › synonym › ready

   • Cached

   Synonyms: quick, ready (a) Antonyms: unready, stupid, off his guard, napping, unripe, off-guard (a), unavailable, off one's guard (p), unintelligent, off your guard, unwilling, off guard (p), unprepared, flat-footed, off her guard. ready adjective. made suitable and available for immediate use. "dinner is ready".

4. www.freethesaurus.com › readyReady synonyms, ready antonyms - FreeThesaurus.com

   www.freethesaurus.com › ready

   • Cached

   Synonyms for ready. Collins. Roget's. WordNet. adj prepared. Synonyms. prepared. set. primed. organized. all set. in readiness. Antonyms. unfit. immature. unprepared. unequipped. adj completed. Synonyms. completed. done. prepared. fixed. arranged. organized. adj mature. Synonyms. mature. ripe.

5. www.onelook.com › thesaurusready: OneLook Thesaurus and Reverse Dictionary

   www.onelook.com › thesaurus

   • Cached

   ready: OneLook Thesaurus and Reverse Dictionary. Enter a word, phrase, description, or pattern above to find synonyms, related words, and more. See. Help. or try one these examples: joyful sporadically small amount strong wind types of enzyme squishy, spongy, gooey. CivicSearch: Search U.S. local government meetings .

6. www.powerthesaurus.org › ready › synonyms2 434 Words for Ready - Power Thesaurus

   www.powerthesaurus.org › ready › synonyms

   • Cached

   Another word for Ready? Words for Ready (other words for Ready).

7. www.oxfordlearnersdictionaries.com › definition › englishready adjective - Definition, pictures, pronunciation and ...

   www.oxfordlearnersdictionaries.com › definition › english

   • Cached

   Definition of ready adjective in Oxford Advanced Learner's Dictionary. Meaning, pronunciation, picture, example sentences, grammar, usage notes, synonyms and more.

8. www.collinsdictionary.com › us › dictionaryREADY definition in American English | Collins English Dictionary

   www.collinsdictionary.com › us › dictionary

   • Cached

   2 days ago · Synonyms: prompt, smart, quick, bright More Synonyms of ready. 7. transitive verb. When you ready something, you prepare it for a particular purpose. [formal] John's soldiers were readying themselves for the final assault. Synonyms: prepare, get set, organize, get ready More Synonyms of ready. More Synonyms of ready.