Yahoo Web Search

Search results

1. Dictionary

   Am·pli·fy

   /ˈampləˌfī/

   

   verb

   • 1. increase the volume of (sound), especially using an amplifier: "the accompanying chords have been amplified in our arrangement" Similar loudenmake louderturn upincreasebooststep upraisemagnifyintensifyescalateswellheightenadd toaugmentsupplementOpposite reducequiet
   • ▪ increase the amplitude of (an electrical signal or other oscillation).
   • ▪ cause to become more marked or intense: "urban policy initiatives amplified social polarization"
   • ▪ make multiple copies of (a gene or DNA sequence).
   • ▪ enlarge upon or add detail to (a story or statement): "the notes amplify information contained in the statement" Similar expandenlarge onelaborate onadd todevelopflesh outadd flesh toadd detail togo into detail aboutembroidersupplementaugmentreinforceOpposite condense

   Word Origin late Middle English (in the general sense ‘increase, augment’): from Old French amplifier, from Latin amplificare, from amplus ‘large, abundant’.

   Scrabble Points: 17

   • A

     1

   • M

     3

   • P

     3

   • L

     1

   • I

     1

   • F

     4

   • Y

     4

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. aws.amazon.com › blogs › mobileNew in AWS Amplify: Expanded Fullstack Deployment ...

   aws.amazon.com › blogs › mobile

   • Cached

   5 days ago · Amplify’s CI/CD system is designed to work really well with this workflow. All of your Amplify code, and therefore your backend and cloud logic, will exist in your codebase in TypeScript code, so your Git branches will contain all the source code needed to deploy your frontend and backend.

3. www.marketingscoop.com › marketing › the-topThe Top Marketing Trends of 2024 & How They‘ve Changed Since ...

   www.marketingscoop.com › marketing › the-top

   • Cached

   1 day ago · Clearly define your brand‘s purpose and values, and ensure they‘re reflected in all of your messaging and visuals; Identify causes and issues that align with your brand values and matter to your customers; Partner with relevant non-profits or advocacy groups to amplify your impact

4. seekingalpha.com › symbol › SWANSWAN Amplify BlackSwan Growth & Treasury Core ETF

   seekingalpha.com › symbol › SWAN

   • Cached

   6 days ago · A high-level overview of Amplify BlackSwan Growth & Treasury Core ETF (SWAN) stock. Stay up to date on the latest stock price, chart, news, analysis, fundamentals, trading and investment tools.

5. devcodef1.com › news › 1255300Using PrimerTrees: A Comprehensive Search for Universal Fish ...

   devcodef1.com › news › 1255300

   • Cached

   1 day ago · PrimerTrees is an R package that provides a comprehensive search tool for universal primer pairs. It uses a phylogenetic tree-based approach to identify primer pairs that can amplify target regions across multiple species. This makes it an ideal tool for developing DNA metabarcoding assays, where the goal is to identify and quantify multiple ...

6. themediabrain.substack.com › p › william-no-thewill.i.am - no, the music industry is not "technology" first ...

   themediabrain.substack.com › p › william-no-the

   1 day ago · Tech can amplify those songs and the artists who sing and write them, enabling them to be heard by more ears. Tech can also help humans transform their songs and their art. Exhibit A is Gary Numan, the UK artist and godfather of synthesizers who created an entirely new genre using tech ( you can listen to my interview with Gary here ).

7. amplifytalent.com › podcast-episodes › canva-amyHow to Become Remarkable With Author Guy Kawasaki — Amplify ...

   amplifytalent.com › podcast-episodes › canva-amy

   • Cached

   1 day ago · Guy Kawasaki on Learning to Become Remarkable. By using this website, you agree to our use of cookies. We use cookies to provide you with a great experience and to help our website run effectively. On this episode of Redefining Work, “Think Remarkable” author Guy Kawasaki explains how growth and grit are the keys to becoming remarkable.

8. seekingalpha.com › news › 4103148-amplify-energyAmplify Energy reports mixed Q1 results; updates FY24 outlook

   seekingalpha.com › news › 4103148-amplify-energy

   5 days ago · Amplify Energy press release (NYSE:AMPY): Q1 GAAP EPS of -$0.24 misses by $0.46. Revenue of $76.3M (-4.5% Y/Y) beats by $1.67M . Generated net cash provided by operating activities of $7.7 million ...