Yahoo Web Search

Search results

1. Dictionary

   Am·pli·fy

   /ˈampləˌfī/

   

   verb

   • 1. increase the volume of (sound), especially using an amplifier: "the accompanying chords have been amplified in our arrangement" Similar loudenmake louderturn upincreasebooststep upraisemagnifyintensifyescalateswellheightenadd toaugmentsupplementOpposite reducequiet
   • ▪ increase the amplitude of (an electrical signal or other oscillation).
   • ▪ cause to become more marked or intense: "urban policy initiatives amplified social polarization"
   • ▪ make multiple copies of (a gene or DNA sequence).
   • ▪ enlarge upon or add detail to (a story or statement): "the notes amplify information contained in the statement" Similar expandenlarge onelaborate onadd todevelopflesh outadd flesh toadd detail togo into detail aboutembroidersupplementaugmentreinforceOpposite condense

   Word Origin late Middle English (in the general sense ‘increase, augment’): from Old French amplifier, from Latin amplificare, from amplus ‘large, abundant’.

   Scrabble Points: 17

   • A

     1

   • M

     3

   • P

     3

   • L

     1

   • I

     1

   • F

     4

   • Y

     4

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. People also ask

   What is amplify?

   • Rather, highlight the date, communicate the date and plan to participate! Previously known as Ignite and run in Queensland, Amplify has for over a decade been Australia’s largest Children & Families ministry training event.

   Amplify (Online) - Uniting Church in Australia. Synod of

   victas.uca.org.au/event/amplify-online/

   See all results for this question

   What does it mean to amplify a sentence?

   • To amplify something means to make it louder or more intense. When referring to writing, amplification means that the writer has added additional details to a sentence in order to make the idea more clear and understandable. In other words, the writer has added additional description to make the meaning more clear. The movie was boring.

   Amplification Examples - Softschools.com

   www.softschools.com/examples/literary_terms/amplification_examples/679/

   See all results for this question

   What does amplifier mean?

   • 1. a person or device that amplifies or enlarges. 2. an electronic component or circuit for amplifying power, current, or voltage. Random House Kernerman Webster's College Dictionary, © 2010 K Dictionaries Ltd. Copyright 2005, 1997, 1991 by Random House, Inc. All rights reserved. An electronic device that increases the strength of a signal. 1.

   Amplifiers - definition of Amplifiers by The Free Dictionary

   www.thefreedictionary.com/Amplifiers

   See all results for this question

   What is amplify ETF?

   • Amplify ETF Trust - Amplify BlackSwan Growth & Treasury Core ETF is an exchange traded fund launched and managed by Amplify Investments LLC. The fund is co-managed by ARGI Investment Services, LLC and Toroso Investments, LLC. It invests in public equity and fixed income markets of the United States.

   Amplify ETF Trust - Amplify BlackSwan Growth & Treasury

   seekingalpha.com/symbol/SWAN

   See all results for this question

3. aws.amazon.com › blogs › mobileNew in AWS Amplify: Expanded Fullstack Deployment ...

   aws.amazon.com › blogs › mobile

   • Cached

   5 days ago · Amplify’s CI/CD system is designed to work really well with this workflow. All of your Amplify code, and therefore your backend and cloud logic, will exist in your codebase in TypeScript code, so your Git branches will contain all the source code needed to deploy your frontend and backend.

4. www.marketingscoop.com › marketing › the-ultimateThe Ultimate Guide to Content Seeding: How to Amplify Reach ...

   www.marketingscoop.com › marketing › the-ultimate

   • Cached

   2 days ago · Content seeding leverages the authority and influence of the people/platforms used to distribute content. Mere exposure effect: The more people are exposed to something, the more they tend to like it. Content seeding puts your content in more places to increase exposure. Curiosity gap: Content seeding often gives a sneak peek or teaser of ...

5. devcodef1.com › news › 1255300Using PrimerTrees: A Comprehensive Search for Universal Fish ...

   devcodef1.com › news › 1255300

   • Cached

   1 day ago · PrimerTrees is an R package that provides a comprehensive search tool for universal primer pairs. It uses a phylogenetic tree-based approach to identify primer pairs that can amplify target regions across multiple species. This makes it an ideal tool for developing DNA metabarcoding assays, where the goal is to identify and quantify multiple ...

6. amplifytalent.com › podcast-episodes › canva-amyHow to Become Remarkable With Author Guy Kawasaki — Amplify ...

   amplifytalent.com › podcast-episodes › canva-amy

   • Cached

   1 day ago · Guy Kawasaki on Learning to Become Remarkable. By using this website, you agree to our use of cookies. We use cookies to provide you with a great experience and to help our website run effectively. On this episode of Redefining Work, “Think Remarkable” author Guy Kawasaki explains how growth and grit are the keys to becoming remarkable.

7. themediabrain.substack.com › p › william-no-thewill.i.am - no, the music industry is not "technology" first ...

   themediabrain.substack.com › p › william-no-the

   1 day ago · Tech can amplify those songs and the artists who sing and write them, enabling them to be heard by more ears. Tech can also help humans transform their songs and their art. Exhibit A is Gary Numan, the UK artist and godfather of synthesizers who created an entirely new genre using tech ( you can listen to my interview with Gary here ).

8. www.reddit.com › r › WatercolorTrying to practice watercolor any advice to improve?

   www.reddit.com › r › Watercolor

   • Cached

   Watercolor can be tricky. You have to map out your work. Watercolor can also be very versatile as a medium bc you can also layer other mediums over it like colored pencil, pastels etc. Keep practicing! 858K subscribers in the Watercolor community. A place for everything to do with watercolor painting. Submit your current paintings, give and ...

9. seekingalpha.com › symbol › SWANSWAN Amplify BlackSwan Growth & Treasury Core ETF

   seekingalpha.com › symbol › SWAN

   • Cached

   6 days ago · A high-level overview of Amplify BlackSwan Growth & Treasury Core ETF (SWAN) stock. Stay up to date on the latest stock price, chart, news, analysis, fundamentals, trading and investment tools.