Yahoo Web Search

Search results

1. Dictionary

   Am·pli·fy

   /ˈampləˌfī/

   

   verb

   • 1. increase the volume of (sound), especially using an amplifier: "the accompanying chords have been amplified in our arrangement" Similar loudenmake louderturn upincreasebooststep upraisemagnifyintensifyescalateswellheightenadd toaugmentsupplementOpposite reducequiet
   • ▪ increase the amplitude of (an electrical signal or other oscillation).
   • ▪ cause to become more marked or intense: "urban policy initiatives amplified social polarization"
   • ▪ make multiple copies of (a gene or DNA sequence).
   • ▪ enlarge upon or add detail to (a story or statement): "the notes amplify information contained in the statement" Similar expandenlarge onelaborate onadd todevelopflesh outadd flesh toadd detail togo into detail aboutembroidersupplementaugmentreinforceOpposite condense

   Word Origin late Middle English (in the general sense ‘increase, augment’): from Old French amplifier, from Latin amplificare, from amplus ‘large, abundant’.

   Scrabble Points: 17

   • A

     1

   • M

     3

   • P

     3

   • L

     1

   • I

     1

   • F

     4

   • Y

     4

   Powered by Oxford Languages

   More Definitions, Word Origin & ScrabbleShow less

2. dictionary.cambridge.org › thesaurus › amplifyAMPLIFY - 33 Synonyms and Antonyms - Cambridge English

   dictionary.cambridge.org › thesaurus › amplify

   • Cached

   verb. These are words and phrases related to amplify. Click on any word or phrase to go to its thesaurus page. Or, go to the definition of amplify. We must amplify our effort by working a lot harder. Synonyms. increase. intensify. strengthen. heighten. raise. expand. broaden. extend. enlarge. widen. lengthen. deepen. Antonyms. reduce. decrease.

3. www.collinsdictionary.com › dictionary › englishAMPLIFIES definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   4 days ago · 1. (transitive) to increase in size, extent, effect, etc, as by the addition of extra material; augment; enlarge; expand. 2. electronics. to produce amplification of (electrical signals); increase the amplitude of (signals) 3. (transitive) US. to exaggerate. 4. (intransitive) to expand or enlarge a speech, narrative, etc.

4. www.betterwordsonline.com › dictionary › amplifyAmplify - Definition, Meaning, Synonyms, Etymology

   www.betterwordsonline.com › dictionary › amplify

   • Cached

   Detailed meaning of amplify. When we amplify, we enhance, enlarge, or strengthen the effect, impact, or importance of a particular subject, idea, sound, or message. It involves the process of making something more pronounced, prominent, or powerful.

5. dictionary.cambridge.org › example › englishAMPLIFY in a sentence | Sentence examples by Cambridge Dictionary

   dictionary.cambridge.org › example › english

   • Cached

   Examples of AMPLIFY in a sentence, how to use it. 99 examples: Secondly, the impact of regulation can be amplified by competitive forces when…

6. www.wordsmyth.netamplify | Dictionaries and vocabulary tools for English ...

   www.wordsmyth.net

   • Cached

   features: Word Combinations ( verb ), Word Explorer. Word Explorer. See. electricity. The meaning of amplify. Definition of amplify. English dictionary and integrated thesaurus for learners, writers, teachers, and students with advanced, intermediate, and beginner levels.

7. www.dictionary.com › browse › overamplifyAMPLIFY Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › overamplify

   • Cached

   verb (used with object), am·pli·fied, am·pli·fy·ing. to make larger, greater, or stronger; enlarge; extend. to expand in stating or describing, as by details or illustrations; clarify by expanding. Electricity. to increase the amplitude of; cause amplification in. Archaic. to exaggerate. See more.

8. www.collinsdictionary.com › dictionary › english-thesaurusAMPLIFY Synonyms | Collins English Thesaurus

   www.collinsdictionary.com › dictionary › english-thesaurus

   • Cached

   3 days ago · Definition. to increase the size, extent, or effect of. The music was amplified with microphones. Synonyms. expand. raise. extend. boost. stretch. strengthen. increase. widen. intensify. heighten. deepen. enlarge. lengthen. magnify. augment. dilate. See examples for synonyms. Opposites. reduce , decrease, cut down , curtail , condense , boil down.